![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf10219g00008.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 105aa MW: 11573.9 Da PI: 8.6146 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 102.8 | 2.1e-32 | 1 | 46 | 14 | 59 |
zf-Dof 14 tntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 ++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k Niben101Scf10219g00008.1 1 METKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAK 46 69******************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50884 | 24.027 | 1 | 47 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.1E-26 | 1 | 46 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 2.0E-21 | 1 | 46 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
METKFCYFNN YNVNQPRHFC KGCQRYWTAG GALRNVPVGA GRRKAKPPCG GSDGDMAAGL 60 SDGCFFDVTN HGNIHQLDFD GVVAEEWHLF PAAKRRRSTS GSQSC |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009794806.1 | 5e-76 | PREDICTED: dof zinc finger protein DOF1.5-like | ||||
Refseq | XP_016436859.1 | 4e-76 | PREDICTED: dof zinc finger protein DOF1.5-like | ||||
Refseq | XP_016492835.1 | 5e-76 | PREDICTED: dof zinc finger protein DOF1.5-like | ||||
Swissprot | P68350 | 3e-36 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
TrEMBL | M1DDW0 | 4e-55 | M1DDW0_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400087458 | 1e-54 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7240 | 22 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29160.1 | 2e-37 | Dof family protein |