PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf10219g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 105aa    MW: 11573.9 Da    PI: 8.6146
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf10219g00008.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof102.82.1e-321461459
                    zf-Dof 14 tntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                              ++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k
  Niben101Scf10219g00008.1  1 METKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAK 46
                              69******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088424.027147IPR003851Zinc finger, Dof-type
PfamPF027013.1E-26146IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-21146IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
METKFCYFNN YNVNQPRHFC KGCQRYWTAG GALRNVPVGA GRRKAKPPCG GSDGDMAAGL  60
SDGCFFDVTN HGNIHQLDFD GVVAEEWHLF PAAKRRRSTS GSQSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794806.15e-76PREDICTED: dof zinc finger protein DOF1.5-like
RefseqXP_016436859.14e-76PREDICTED: dof zinc finger protein DOF1.5-like
RefseqXP_016492835.15e-76PREDICTED: dof zinc finger protein DOF1.5-like
SwissprotP683503e-36DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLM1DDW04e-55M1DDW0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000874581e-54(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA72402232
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.12e-37Dof family protein